missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Proline Rich 35 Antibody, Novus Biologicals™

Proline Rich 35 Antibody, Novus Biologicals™

Product Code. p-200057879 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18645006 0.1 mL 0.10mL
18689105 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18645006 Supplier Novus Biologicals Supplier No. NBP248809

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Proline Rich 35 Polyclonal antibody specifically detects Proline Rich 35 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Proline Rich 35
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias chromosome 16 open reading frame 11, hypothetical protein LOC146325, LA16c-366D1.2, Uncharacterized protein RJD1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: EHVGEDLTRALGDYARVEQRLGQLGPAGGLAPRPLREQLGKIRLELLTIHQALEQAVRPPDAPLDLSVKRA
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 146325
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.