missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PRKACB (Human) Recombinant Protein

Human PRKACB full-length ORF ( AAH16285, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00005567-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16159541

  • 545.00€ / 25µg

Estimated Shipment: 22-08-2022
to see stock.
Add to basket

Description

Description

  • Sequence: MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKNF
Specifications

Specifications

AAH16285
protein kinase, cAMP-dependent, catalytic, beta
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PRKACB
GST
5567
Wheat germ expression system
25 μg
DKFZp781I2452, MGC41879, MGC9320, PKACB
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers