missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PRKACB (Human) Recombinant Protein

Name: Abnova&trade; PRKACB (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16159541
Price: 508.00 EUR

Human PRKACB full-length ORF ( AAH16285, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00005567-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16159541

Quantity

Estimated Shipment: 06-06-2024
to see stock.

Add to basket

Description

Sequence: MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKNF

Specifications

Accession Number	AAH16285
Name	protein kinase, cAMP-dependent, catalytic, beta
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	PRKACB
Protein Tag	GST

Gene ID (Entrez)	5567
Preparation Method	Wheat germ expression system
Quantity	25 μg
Gene Alias	DKFZp781I2452, MGC41879, MGC9320, PKACB
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description