missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PRKACB (Human) Recombinant Protein

Human PRKACB full-length ORF ( AAH16285, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal.

335.00€ - 508.00€

Accession Number	AAH16285
Gene ID (Entrez)	5567
Name	protein kinase, cAMP-dependent, catalytic, beta
Preparation Method	Wheat germ expression system
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16149541 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00005567-P01.10UG	10 μg	335.00€ 10µg View alternative products Save Up to »	Estimated Shipment: 31-05-2024 Log in to see stock.	Add to basket

16159541 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00005567-P01.25UG	25 μg	508.00€ 25µg View alternative products Save Up to »	Estimated Shipment: 31-05-2024 Log in to see stock.	Add to basket

Description

Sequence: MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKNF

Specifications

Accession Number	AAH16285
Name	protein kinase, cAMP-dependent, catalytic, beta
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Gene Alias	DKFZp781I2452, MGC41879, MGC9320, PKACB
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Gene ID (Entrez)	5567
Preparation Method	Wheat germ expression system
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	PRKACB
Protein Tag	GST

Description