missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PPRC1 Antibody, Novus Biologicals™

PPRC1 Antibody, Novus Biologicals™

Código de producto. 18605158 Tienda Bio Techne Productos
Change view
Click to view available options
Quantity:
100 μL
25 μL
Tamaño de la unidad:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity unitSize
18605158 25 μL 25µL
18252691 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18605158 Proveedor Novus Biologicals N.º de proveedor NBP25582225ul

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

PPRC1 Polyclonal specifically detects PPRC1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen PPRC1
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias KIAA0595gamma, coactivator-related 1, peroxisome proliferator-activated receptor gamma, coactivator-related 1, PGC-1 related co-activator, PGC-1-related coactivator
Gene Symbols PPRC1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LKPEGVTEAKHPAAVRLQEGVHGPSRVHVGSGDHDYCVRSRTPPKKMPALVIPEVGSRWNVKRHQDITIKPVLSLGPAAPPPPCIAASREPLDHRTSSEQADPSAP
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23082
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°CC long term. Avoid freeze/thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.