missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PPM1E Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33546-100ul
This item is not returnable.
View return policy
Description
PPM1E Monoclonal antibody specifically detects PPM1E in Human samples. It is validated for ELISA,Western Blot
Specifications
| PPM1E | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| ca(2+)/calmodulin-dependent protein kinase phosphatase N, CAMKN, CaMKP-N, caMKP-nucleus, DKFZp781F1422, KIAA1072, nuclear calmodulin-dependent protein kinase phosphatase, partner of PIX 1, partner of PIXA, partner of PIX-alpha, POPX1, PP2CH, protein phosphatase 1E, protein phosphatase 1E (PP2C domain containing), protein phosphatase, Mg2+/Mn2+ dependent, 1E | |
| A synthetic peptide corresponding to a sequence within amino acids 500-600 of human PPM1E (Q8WY54).,, Sequence:, ESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLEDPGYLDLTQIEASKPHSAQFLLPVEMFGPGAPKKA | |
| 100 μL | |
| Protein Phosphatase | |
| 22843 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction