missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PP14/Glycodelin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 529.00€
Specifications
| Antigen | PP14/Glycodelin |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18454451
|
Novus Biologicals
NBP1-89781-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18255198
|
Novus Biologicals
NBP1-89781 |
0.1 mL |
529.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PP14/Glycodelin Polyclonal specifically detects PP14/Glycodelin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PP14/Glycodelin | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| alpha uterine protein, GdF, GdS, glycodelin, glycodelin-A, glycodelin-F, glycodelin-S, MGC138509, MGC142288, PEP, Placental protein 14, PP14 protein (placental protein 14), PP14GDPAEGGdA, pregnancy-associated endometrial a, Pregnancy-associated endometrial alpha-2 globulin, pregnancy-associated endometrial alpha-2-globulin, progestagen-associated endometrial protein (placental protein 14, progestagen-associated endometrial proteinPEG, Progesterone-associated endometrial protein | |
| PAEP | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Developmental Biology | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5047 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title