missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POMT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
484.00€
Specifications
| Antigen | POMT2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
POMT2 Polyclonal specifically detects POMT2 in Human samples. It is validated for Western Blot.Specifications
| POMT2 | |
| Polyclonal | |
| Rabbit | |
| Q9UKY4 | |
| 29954 | |
| Synthetic peptides corresponding to POMT2(protein-O-mannosyltransferase 2) The peptide sequence was selected from the middle region of POMT2. Peptide sequence RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp686G10254, Dolichyl-phosphate-mannose--protein mannosyltransferase 2, EC 2.4.1.109, FLJ22309, MDDGA2, MDDGB2, MDDGC2, protein O-mannosyl-transferase 2, protein-O-mannosyltransferase 2 | |
| POMT2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title