missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. POMGNT2 Antibody, R&D Systems™

POMGNT2 Antibody, R&D Systems™

Produktkode 18289585 Shop alle Bio Techne produkter
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
Förpackningsstorlek:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkode Quantity Förpackningsstorlek
18289585 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 missing translation for 'options'
Denne vare kan ikke returneres. Se returpolitik
Produktkode 18289585 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP179305
 Restricted Item
Estimated Shipment: 09-10-2026
Tilføj til indkøbskurv
Tilføj til indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolitik

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

C3orf39 Polyclonal specifically detects C3orf39 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen C3orf39
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_116195
Gene Alias AGO61, C3orf39, chromosome 3 open reading frame 39, EC 2.4, FLJ14566, glycosyltransferase, glycosyltransferase-like domain containing 2, MDDGA8
Gene Symbols GTDC2
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human C3orf39The immunogen for this antibody is C3ORF39. Peptide sequence TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 84892
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Vis mere Vis mindre

For Research Use Only

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.