missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PNMA-like 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | PNMA-like 1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PNMA-like 1 Polyclonal specifically detects PNMA-like 1 in Human samples. It is validated for Western Blot.Specifications
| PNMA-like 1 | |
| Polyclonal | |
| Rabbit | |
| Q86V59 | |
| 55228 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ10781, KIAA1183L, PNMA-like 1, PNMA-like protein 1 | |
| Synthetic peptides corresponding to PNMAL1 (PNMA-like 1) The peptide sequence was selected from the middle region of PNMAL1)(50ug). Peptide sequence APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title