missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PMP70 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 572.00€
Specifications
| Antigen | PMP70 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18663126
|
Novus Biologicals
NBP2-38199-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18116678
|
Novus Biologicals
NBP2-38199 |
0.1 mL |
572.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PMP70 Polyclonal specifically detects PMP70 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| PMP70 | |
| Polyclonal | |
| Rabbit | |
| ABC Transporters, Cellular Markers, Lipid and Metabolism, Neuroscience, Peroxisome Markers, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 70 kDa peroxisomal membrane protein, ABC43, ATP-binding cassette, sub-family D (ALD), member 3, peroxisomal membrane protein 1 (70kD, Zellweger syndrome), Peroxisomal membrane protein-1 (70kD), PMP70ATP-binding cassette sub-family D member 3, PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1)), ZWS2 | |
| ABCD3 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P28288 | |
| 5825 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title