missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PLA2G4A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38616-25ul
305.15 EUR valid until 2025-12-16
BEST PRICE on Promo! Use promo code "24090" to get your promotional price.
This item is not returnable.
View return policy
Description
PLA2G4A Polyclonal specifically detects PLA2G4A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| PLA2G4A | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| P47712 | |
| PLA2G4A | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQ | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| calcium-dependent phospholipid-binding protein, cPLA2, cPLA2-alpha, lysophospholipase, MGC126350, phosphatidylcholine 2-acylhydrolase, Phospholipase A2 group IVA, phospholipase A2, group IVA (cytosolic, calcium-dependent), PLA2G4°Cytosolic phospholipase A2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 5321 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction