missing translation for 'onlineSavingsMsg'
Learn More

PKC mu Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. p-200062782 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18656582 0.02 mL 0.02mL
18690282 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18656582 Supplier Novus Biologicals Supplier No. NBP2940000.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PKC mu Polyclonal antibody specifically detects PKC mu in Human, Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen PKC mu
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias EC 2.7.11, nPKC-D1, nPKC-mu, PKCM, PKC-MU, PKD1, PKDEC 2.7.11.13, PRKCMPKC-mu, Protein kinase C mu type, protein kinase C, mu, Protein kinase D, protein kinase D1, serine/threonine-protein kinase D1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-900 of human PKC mu (NP_002733.2). YPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQDYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEET
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Golgi Apparatus Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5587
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.