missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PKC mu Polyclonal antibody specifically detects PKC mu in Human, Mouse samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | PKC mu |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | EC 2.7.11, nPKC-D1, nPKC-mu, PKCM, PKC-MU, PKD1, PKDEC 2.7.11.13, PRKCMPKC-mu, Protein kinase C mu type, protein kinase C, mu, Protein kinase D, protein kinase D1, serine/threonine-protein kinase D1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 800-900 of human PKC mu (NP_002733.2). YPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQDYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEET |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?