missing translation for 'onlineSavingsMsg'
Learn More

PITX2 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand: Novus Biologicals NBP3-33337-20ul

View more versions of this product

Product Code. 30227689

213.00€ / 20µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

PITX2 Monoclonal antibody specifically detects PITX2 in Human samples. It is validated for ELISA,Western Blot

Specifications

Antigen	PITX2
Classification	Monoclonal
Dilution	Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL
Gene Alias	all1-responsive gene 1, ALL1-responsive protein ARP1, ARP1MGC20144, Homeobox protein PITX2, IDG2, IGDS, IGDS2, IHG2, IRID2, Otlx2, paired-like homeodomain 2, Paired-like homeodomain transcription factor 2MGC111022, pituitary homeo box 2, pituitary homeobox 2, PTX2, RGSRIEG1Brx1, RIEG, RIEG bicoid-related homeobox transcription factor, rieg bicoid-related homeobox transcription factor 1, RS, solurshin
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PITX2 (NP_700475.1).,, Sequence:, METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQEL
Quantity	20 μL
Research Discipline	Stem Cell Markers
Gene ID (Entrez)	5308
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	PBS (pH 7.3), 50% glycerol, 0.05% BSA
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

PITX2 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions