missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pit1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 574.00€
Specifications
| Antigen | Pit1 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18027823
|
Novus Biologicals
NBP2-55357 |
100 μL |
574.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18698336
|
Novus Biologicals
NBP2-55357-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Pit1 Polyclonal specifically detects Pit1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Pit1 | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| CPHD1, GHF1, GHF-1pituitary-specific positive transcription factor 1, Growth hormone factor 1, PIT-1, PIT1pituitary-specific transcription factor 1, POU class 1 homeobox 1, POU domain class 1, transcription factor 1, POU domain, class 1, transcription factor 1, POU1F1a | |
| POU1F1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Breast Cancer, Cell Cycle and Replication | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5449 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title