missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PHLPP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35806-100ul
This item is not returnable.
View return policy
Description
PHLPP2 Polyclonal antibody specifically detects PHLPP2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| PHLPP2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| EC 3.1.3.16, KIAA0931PH domain leucine-rich repeat-containing protein phosphatase 2, PH domain and leucine rich repeat protein phosphatase 2, PH domain and leucine rich repeat protein phosphatase-like, PH domain leucine-rich repeat-containing protein phosphatase-like, PHLPPLPHLPP-like | |
| A synthetic peptide corresponding to a sequence within amino acids 1250-1323 of human PHLPP2 (NP_055835.2).,, Sequence:, DSLNLIEVATEVPKRKTGYFAAPTQMEPEDQFVVPHDLEEEVKEQMKQHQDSRLEPEPHEEDRTEPPEEFDTAL | |
| 100 μL | |
| Cancer, Tumor Suppressors | |
| 23035 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction