missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PHKG2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65€ - 590.10€
Specifications
| Antigen | PHKG2 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18299973
|
Novus Biologicals
NBP2-55815 |
100 μL |
624.00€ 590.10€ / 100µL Save 33.90€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18678146
|
Novus Biologicals
NBP2-55815-25ul |
25 μL |
415.00€ 391.65€ / 25µL Save 23.35€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PHKG2 Polyclonal specifically detects PHKG2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| PHKG2 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5261 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 2.7.11, EC 2.7.11.19, GSD9C, PHK-gamma-T, phosphorylase b kinase gamma catalytic chain, testis/liver isoform, Phosphorylase kinase subunit gamma-2, phosphorylase kinase, gamma 2 (testis), Phosphorylase kinase, gamma 2 (testis/liver), PSK-C3 | |
| PHKG2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title