missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PGM1 Antibody (CL3299), Novus Biologicals™
Mouse Monoclonal Antibody
280.00€ - 572.00€
Specifications
| Antigen | PGM1 |
|---|---|
| Clone | CL3299 |
| Applications | Western Blot, Immunohistochemistry |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18282983
|
Novus Biologicals
NBP2-61618 |
100 μL |
572.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18614609
|
Novus Biologicals
NBP2-61618-25ul |
25 μL |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PGM1 Monoclonal specifically detects PGM1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PGM1 | |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| Mouse | |
| Human | |
| 5236 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SILATRKQSVEDILKDHWQKHGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| CL3299 | |
| Monoclonal | |
| Purified | |
| Lipid and Metabolism | |
| EC 5.4.2, EC 5.4.2.2, Glucose phosphomutase 1, GSD14, PGM 1, phosphoglucomutase 1, phosphoglucomutase-1 | |
| PGM1 | |
| IgG1 | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title