missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PGC-1 beta Antibody - Azide and BSA Free, R&D Systems™

PGC-1 beta Antibody - Azide and BSA Free, R&D Systems™

Product Code. 18604792 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18604792 0.02 mL 0.02mL
18691622 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18604792 Supplier Novus Biologicals Supplier No. NBP2942380.02ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

PGC-1 beta Polyclonal antibody specifically detects PGC-1 beta in Human, Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen PGC-1 beta
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias DKFZp686C1790, ERRL1, PERCFLJ14284, peroxisome proliferator-activated receptor gamma, coactivator 1 beta, PGC1, PGC1Bgamma, coactivator 1, beta, PPARGC1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 850-950 of human PGC1 beta (NP_001166170.1). SSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSL
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, Chromatin Research, Diabetes Research, Hypoxia, Lipid and Metabolism, Mitochondrial Markers, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 133522
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.