missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PFKL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
486.00€
Specifications
| Antigen | PFKL |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Beschreibung
PFKL Polyclonal specifically detects PFKL in Human, Mouse samples. It is validated for Western Blot.Spezifikation
| PFKL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q7L2M7 | |
| 5211 | |
| Synthetic peptides corresponding to PFKL(phosphofructokinase, liver) The peptide sequence was selected from the middle region of PFKL. Peptide sequence RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| 6-phosphofructokinase, liver type, DKFZp686G1648, DKFZp686L2097, EC 2.7.1, EC 2.7.1.11, FLJ30173, FLJ40909, human liver-type 1-phosphofructokinase, EC 2.7.1.1110Phosphohexokinase, liver-type 1-phosphofructokinase, PFK-B, Phosphofructo-1-kinase isozyme B, Phosphofructokinase 1, phosphofructokinase, liver, phosphohexokinase | |
| PFKL | |
| IgG | |
| Protein A purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts