missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PDZD8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€
Specifications
| Antigen | PDZD8 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PDZD8 Polyclonal specifically detects PDZD8 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PDZD8 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| bA129M16.2, FLJ25412, FLJ34427, PDZ domain containing 8, PDZ domain-containing protein 8, PDZK8, sarcoma antigen NY-SAR-104, sarcoma antigen NY-SAR-84, Sarcoma antigen NY-SAR-84/NY-SAR-104 | |
| PDZD8 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 118987 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DEEHIHIQQWALTEGRLKVTLLECSRLLIFGSYDREANVHCTLELSSSVWEEKQRSSIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVIIETVAPNSPAAIADLQRGDR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title