missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PDZD8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€
Specifications
| Antigen | PDZD8 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PDZD8 Polyclonal specifically detects PDZD8 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PDZD8 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| bA129M16.2, FLJ25412, FLJ34427, PDZ domain containing 8, PDZ domain-containing protein 8, PDZK8, sarcoma antigen NY-SAR-104, sarcoma antigen NY-SAR-84, Sarcoma antigen NY-SAR-84/NY-SAR-104 | |
| PDZD8 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 118987 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DEEHIHIQQWALTEGRLKVTLLECSRLLIFGSYDREANVHCTLELSSSVWEEKQRSSIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVIIETVAPNSPAAIADLQRGDR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.