missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PDK1
PDK1
Brand: Thermo Scientific P3001
Additional Details : Weight : 0.00001kg
Description
PDK1 (3-phosphoinositide dependent kinase-1) is a serine⁄threonine protein kinase localized to the plasma membrane. It plays a vital role in insulin-induced glycogen synthesis, PKC activation, and activation of the AGC subfamily of protein kinases.Specifications
NP_002604 | |
Pharma and Biopharma, Protein Assays and Analysis, Target and Lead Identification and Validation, Kinase Assay | |
66.9kDa | |
7.5 | |
–80°C | |
1 Each | |
PDK1 | |
PDHK | |
184nmoles of phosphate transferred to PDK1 substrate (DGVTTKTFAGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADW) per minute per mg of total protein at 30°C. Activity determined at a final protein concentration of 1μg/mL | |
His Tag | |
Kinase and inhibitors | |
70% by SDS-PAGE |
0.2mg/mL | |
5163, 5170 | |
PDK1 | |
5μg | |
For research use only. Not for use in diagnostic procedures | |
PDK-1 | |
PDK1 was pre-diluted in enzyme dilution buffer and assayed in 50mM Tris (pH 7.5), 15mM MgCl2, 2.5mM DTT, 5mM EGTA, 200μM ATP, 100μM PDK1 substrate (DGVTTKTFAGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADW) and trace [32P]-γ-ATP for 10 minutes at 30°C | |
PDK1 | |
Human | |
Baculovirus | |
Serine/threonine kinase |
For Research Use Only. Not for use in diagnostic procedures.