missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PDGF-D/SCDGFB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38087-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
PDGF-D/SCDGFB Polyclonal specifically detects PDGF-D/SCDGFB in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Spécification
| PDGF-D/SCDGFB | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q9GZP0 | |
| PDGFD | |
| This antibody was developed against a recombinant protein corresponding to amino acids: YNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMYLDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTP | |
| 25 μL | |
| Vision | |
| 80310 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| IEGFMSTP036, Iris-expressed growth factor, PDGF-D, platelet derived growth factor D, SCDGF-BMGC26867, SCDGFBplatelet-derived growth factor D, spinal cord derived growth factor B, Spinal cord-derived growth factor B, spinal cord-derived growth factor-B | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu