missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PCSK4 (Human) Recombinant Protein

Human PCSK4 full-length ORF ( AAH36354, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00054760-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16160733

  • 359.00€ / 10µg

Estimated Shipment: 24-08-2022
to see stock.
Add to basket

Description

Description

  • Sequence: MGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLSLLAVTLGGPVLCGMSMDLPLYAWLSRARATPTKPQVWLPAGT
Specifications

Specifications

AAH36354
proprotein convertase subtilisin/kexin type 4
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PCSK4
GST
54760
Wheat germ expression system
10 μg
DKFZp434B217, MGC34749, PC4, SPC5
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers