missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PANK4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
466.00€
Specifications
| Antigen | PANK4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PANK4 Polyclonal specifically detects PANK4 in Human samples. It is validated for Western Blot.Specifications
| PANK4 | |
| Polyclonal | |
| Rabbit | |
| Q9NVE7 | |
| 55229 | |
| Synthetic peptides corresponding to PANK4(pantothenate kinase 4) The peptide sequence was selected from the N terminal of PANK4. Peptide sequence MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp547M242, EC 2.7.1.33, FLJ10782, hPanK4, pantothenate kinase 4, Pantothenic acid kinase 4 | |
| PANK4 | |
| IgG | |
| 86 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title