missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAIP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38802
This item is not returnable.
View return policy
Description
PAIP2 Polyclonal specifically detects PAIP2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| PAIP2 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q9BPZ3 | |
| PAIP2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYM | |
| 0.1 mL | |
| metabolism | |
| 51247 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| MGC72018, PABC1-interacting protein 2, PABP-interacting protein 2, PAIP-2, PAIP2APoly(A)-binding protein-interacting protein 2, poly(A) binding protein interacting protein 2, polyA-binding protein-interacting protein 2, polyadenylate-binding protein-interacting protein 2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction