missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PAFAH1B3 (Human) Recombinant Protein

Human PAFAH1B3 full-length ORF ( AAH03016, 1 a.a. - 231 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00005050-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16158671

  • 545.00€ / 25µg

Estimated Shipment: 22-08-2022
to see stock.
Add to basket

Description

Description

  • Sequence: MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
Specifications

Specifications

AAH03016
platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
5050
Wheat germ expression system
25 μg
PAFAH1B3
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers