missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PABPC4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00€ - 550.00€
Specifications
| Antigen | PABPC4 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231766
|
Novus Biologicals
NBP3-38218-100ul |
100 μL |
550.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228304
|
Novus Biologicals
NBP3-38218-20ul |
20 μL |
190.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PABPC4 Polyclonal antibody specifically detects PABPC4 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ImmunofluorescenceSpecifications
| PABPC4 | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| APP1FLJ43938, APP-1PABP-4, Inducible poly(A)-binding protein, IPABP, iPABPpoly(A)-binding protein, cytoplasmic 4 (inducible form), PABP4Activated-platelet protein 1, poly(A) binding protein, cytoplasmic 4 (inducible form), Poly(A)-binding protein 4, polyadenylate-binding protein 4 | |
| A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PABPC4 (NP_003810.1).,, Sequence:, VTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMP | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 8761 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title