missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p53 AIP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00€ - 550.00€
Specifications
| Antigen | p53 AIP1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231529
|
Novus Biologicals
NBP3-38400-100ul |
100 μL |
550.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30230274
|
Novus Biologicals
NBP3-38400-20ul |
20 μL |
190.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
p53 AIP1 Polyclonal antibody specifically detects p53 AIP1 in Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| p53 AIP1 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, DNA Repair | |
| PBS (pH 7.3), 50% glycerol | |
| 63970 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| p53AIP1, p53-regulated apoptosis-inducing protein 1, tumor protein p53 regulated apoptosis inducing protein 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human p53 AIP1 (NP_001238893.1).,, Sequence:, MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title