missing translation for 'onlineSavingsMsg'
Learn More
Learn More
P2Y1/P2RY1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38455-20ul
This item is not returnable.
View return policy
Description
P2Y1/P2RY1 Polyclonal antibody specifically detects P2Y1/P2RY1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| P2Y1/P2RY1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| ATP receptor, P2 purinoceptor subtype Y1, P2Y purinoceptor 1, P2Y1platelet ADP receptor, Purinergic receptor, purinergic receptor P2Y, G-protein coupled, 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 274-373 of human P2Y1/P2RY1 (NP_002554.1).,, Sequence:, IPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL | |
| 20 μL | |
| Apoptosis, Cytokine Research, GPCR, Plasma Membrane Markers | |
| 5028 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction