missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OVGP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | OVGP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
OVGP1 Polyclonal specifically detects OVGP1 in Human samples. It is validated for Western Blot.Specifications
| OVGP1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CHIT5, EGP, Estrogen-dependent oviduct protein, MUC9, mucin 9, mucin-9, OGP, oviduct glycoprotein, Oviductal glycoprotein, oviductal glycoprotein 1, 120kDa, oviductin, oviduct-specific glycoprotein | |
| OVGP1 | |
| IgG | |
| 75 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_002548 | |
| 5016 | |
| Synthetic peptide directed towards the C terminal of human OVGP1The immunogen for this antibody is OVGP1. Peptide sequence QLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEEA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title