missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Orc2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35589-20ul
This item is not returnable.
View return policy
Description
Orc2 Polyclonal antibody specifically detects Orc2 in Human samples. It is validated for ELISA,Western Blot
Specifications
| Orc2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| ORC2Lorigin recognition complex subunit 2, origin recognition complex protein 2 homolog, origin recognition complex, subunit 2, origin recognition complex, subunit 2 (yeast homolog)-like, origin recognition complex, subunit 2 homolog, origin recognition complex, subunit 2 homolog (yeast), origin recognition complex, subunit 2-like, origin recognition complex, subunit 2-like (yeast) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 458-577 of human Orc2 (NP_006181.1).,, Sequence:, TSYENSLLVKQSGSLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA | |
| 20 μL | |
| Cell Cycle and Replication | |
| 4999 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction