missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Orai1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38425-20ul
This item is not returnable.
View return policy
Description
Orai1 Polyclonal antibody specifically detects Orai1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Orai1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| CRACM1ORAT1, FLJ14466, ORAI calcium release-activated calcium modulator 1, Protein orai-1, TMEM142Acalcium release-activated calcium modulator 1, Transmembrane protein 142Acalcium release-activated calcium channel protein 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Orai1 (NP_116179.2).,, Sequence:, MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFA | |
| 20 μL | |
| Cancer, Neuroscience | |
| 84876 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur