missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Orai1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38425-20ul
This item is not returnable.
View return policy
Description
Orai1 Polyclonal antibody specifically detects Orai1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Orai1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| CRACM1ORAT1, FLJ14466, ORAI calcium release-activated calcium modulator 1, Protein orai-1, TMEM142Acalcium release-activated calcium modulator 1, Transmembrane protein 142Acalcium release-activated calcium channel protein 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Orai1 (NP_116179.2).,, Sequence:, MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFA | |
| 20 μL | |
| Cancer, Neuroscience | |
| 84876 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction