missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ OIP5 Recombinant Protein

Brand:  Abnova™ H00011339-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16106582

  • 508.00€ / 25µg
Estimated Shipment: 26-06-2024
to see stock.
Add to basket

Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH15050
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
51.3
8
Glutathione Sepharose 4 Fast Flow
25 ug
MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN
5730547N13Rik/LINT-25/MIS18beta
OIP5
Wheat Germ (in vitro)
GST
Antibody Production, Protein Array, ELISA, Western Blot
11339
OIP5 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OIP5
Human
Recombinant
Solution
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers