missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. OAT1 Antibody - BSA Free, Novus Biologicals™

OAT1 Antibody - BSA Free, Novus Biologicals™

Product Code. 18641691 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.01mL
0.02mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18641691 0.02 mL 0.02mL
18605621 0.1 mL 0.01mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18641691 Supplier Novus Biologicals Supplier No. NBP2944740.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

OAT1 Polyclonal antibody specifically detects OAT1 in Human, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen OAT1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias hOAT1, hPAHT, hROAT1, MGC45260, OAT1FLJ55736, Organic anion transporter 1, PAH transporter, PAHTHOAT1, para-aminohippurate transporter, Renal organic anion transporter 1, ROAT1, solute carrier family 22 (organic anion transporter), member 6, solute carrier family 22 member 6
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 31-135 of human OAT1 (NP_004781.2). MASHNTLQNFTAAIPTHHCRPPADANLSKNGGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSHRALRQ
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9356
Target Species Human, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.