missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nuclear Factor Erythroid 2 Related Factor 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 589.00€
Specifications
| Antigen | Nuclear Factor Erythroid 2 Related Factor 1 |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18643746
|
Novus Biologicals
NBP2-39057-25ul |
25 μL |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18116667
|
Novus Biologicals
NBP2-39057 |
0.1 mL |
589.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Nuclear Factor Erythroid 2 Related Factor 1 Polyclonal specifically detects Nuclear Factor Erythroid 2 Related Factor 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Nuclear Factor Erythroid 2 Related Factor 1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ00380, HBZ17, LCR-F1, Locus control region-factor 1, NF-E2-related factor 1, NFE2-related factor 1, NRF1TCF11, nuclear factor (erythroid-derived 2)-like 1, nuclear factor erythroid 2-related factor 1, Nuclear factor, erythroid derived 2, like 1, TCF-11, Transcription factor 11, transcription factor 11 (basic leucine zipper type), Transcription factor HBZ17, Transcription factor LCR-F1 | |
| NFE2L1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q14494 | |
| 4779 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title