missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NSDHL Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33288-20ul
This item is not returnable.
View return policy
Description
NSDHL Monoclonal antibody specifically detects NSDHL in Human samples. It is validated for ELISA,Western Blot
Specifications
| NSDHL | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| EC 1.1.1.170, H105e3, member 1, NAD(P) dependent steroid dehydrogenase-like, SDR31E1, sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating, XAP104 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human NSDHL (NP_057006.1).,, Sequence:, GQHMVEQLLARGYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCASPPPSSNNKELFYRVNYIGTKNVIETCKEAGVQKLILTSSASVIF | |
| 20 μL | |
| metabolism | |
| 50814 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction