missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NrCAM Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
466.00€
Specifications
| Antigen | NrCAM |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NrCAM Polyclonal specifically detects NrCAM in Human samples. It is validated for Western Blot.Specifications
| NrCAM | |
| Polyclonal | |
| Rabbit | |
| Q4KMQ7 | |
| 4897 | |
| Synthetic peptides corresponding to NRCAM(neuronal cell adhesion molecule) The peptide sequence was selected from the N terminal of NRCAM. Peptide sequence PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| bravo, hBravo, KIAA0343Neuronal surface protein Bravo, MGC138845, MGC138846, neuronal cell adhesion molecule, Ng-CAM-related, NgCAM-related cell adhesion molecule, nr-CAM | |
| NRCAM | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title