missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 18727573

Novus Biologicals™ Recombinant Human Myosin Light Chain 2 His Protein

Product Code. 18727573 Shop All Bio Techne Products
Click to view available options
:
0.1mg; Unlabeled
This item is not returnable. View return policy

Product Code. 18727573

Brand: Novus Biologicals™ NBC118536

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids1-166 of Human Myosin Light Chain 2 The Recombinant Human Myosin Light Chain 2 Protein is derived from E. coli. The Recombinant Human Myosin Light Chain 2 Protein has been validated for the following applications: SDS-Page.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number NP_000423
For Use With (Application) ELISA, SDS-PAGE
Formulation 20mM Tris-HCl buffer (pH 8.0), 40% glycerol, 5mM CaCl2
Gene ID (Entrez) 4633
Molecular Weight (g/mol) 20.9kDa
Name Myosin Light Chain 2 Protein
Purification Method Protein
Immunogen MGSSHHHHHHSSGLVPRGSHMAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Endotoxin Concentration <1 EU per 1ug of protein (determined by LAL method)
Cross Reactivity Human
Purity or Quality Grade >95%, by SDS-PAGE
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.