missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 18242881

Novus Biologicals™ Recombinant Human CRABP2 Protein

Product Code. 18242881 Shop All Bio Techne Products
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
This item is not returnable. View return policy

Product Code. 18242881

Brand: Novus Biologicals™ NBC118490

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids1-138 of Human E.coli CRABP2 The Recombinant Human CRABP2 Protein is derived from E. coli. The Recombinant Human CRABP2 Protein has been validated for the following applications: SDS-Page.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number NP_001869
Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation 20 mM Tris-HCl buffer (pH 8.0), 20% glycerol
Gene ID (Entrez) 1382
Molecular Weight (g/mol) M.W. (theoretical): 15.6 kDa
Name CRABP2 Protein
Purification Method Protein
Quantity 0.1 mg
Immunogen MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
Storage Requirements Store at 4 C short term. Aliquot and store (at -20 C long term. Avoid freeze-thaw cycles.)
Endotoxin Concentration <1.0 EU / 1 μg of protein (determined by LAL method)
Gene Symbol CRABP2
Cross Reactivity Human
Research Category Core ESC Like Genes, Neuroscience, Stem Cell Markers
Purity or Quality Grade >95%, by SDS-PAGE
Protein CRABP2
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.