missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
NOL10 Polyclonal antibody specifically detects NOL10 in Human, Mouse samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | NOL10 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | FLJ13938, FLJ14075, H_NH0074G24.1, nucleolar protein 10, polyglutamine binding protein 5, PQBP5 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human NOL10 (NP_079170.2). KNSGKIFTSLEPEHDLNDVCLYPNSGMLLTANETPKMGIYYIPVLGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTKKDLENLGLTHLIGSPFLRAYMH |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?