missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NHLH1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93392-0.1ml
This item is not returnable.
View return policy
Description
NHLH1 Polyclonal antibody specifically detects NHLH1 in Human samples. It is validated for Western Blot
Specifications
| NHLH1 | |
| Polyclonal | |
| Western Blot 1:1000 - 1:5000 | |
| BHLHA35, bHLHa35HEN-1, helix-loop-helix protein 1, HEN1NSCL-1, nescient helix loop helix 1Class A basic helix-loop-helix protein 35, NSCL, NSCL1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human NHLH1 (NP_005589.1). MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQH | |
| 0.1 mL | |
| Neuroscience | |
| 4807 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction