missing translation for 'onlineSavingsMsg'
Learn More

NHERF-2 Antibody, Novus Biologicals™

Product Code. 18277997 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18277997 0.1 mL 0.10mL
18417530 25ul 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18277997 Supplier Novus Biologicals Supplier No. NBP184944

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

NHERF-2 Polyclonal specifically detects NHERF-2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen NHERF-2
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q15599
Gene Alias E3KARP, Na(+)/H(+) exchange regulatory cofactor NHE-RF2, NHE3RF2, NHERF2MGC104639, NHERF-2NHE3 kinase A regulatory protein E3KARP, OCTS2, SIP-1SRY-interacting protein 1, sodium/hydrogen exchanger, Sodium-hydrogen exchanger regulatory factor 2, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 2, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulatoryfactor 2, solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 2, Solute carrier family 9 isoform A3 regulatory factor 2, TKA-1SIP1, Tyrosine kinase activator protein 1
Gene Symbols SLC9A3R2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLH
Molecular Weight of Antigen 37 kDa
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9351
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.