missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NFkB p105/p50 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
214.00€ - 584.00€
Specifications
| Antigen | NFkB p105/p50 |
|---|---|
| Dilution | Western Blot 1:100 - 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232575
|
Novus Biologicals
NBP3-38305-20ul |
20 μL |
214.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227036
|
Novus Biologicals
NBP3-38305-100ul |
100 μL |
584.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NFkB p105/p50 Polyclonal antibody specifically detects NFkB p105/p50 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ImmunofluorescenceSpecifications
| NFkB p105/p50 | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cancer, Cell Biology, Diabetes Research, DNA Repair, Neurodegeneration, Neuroscience, Nucleotide Excision Repair, Phospho Specific, Signal Transduction, Transcription Factors and Regulators | |
| PBS (pH 7.3), 50% glycerol | |
| 4790 | |
| IgG | |
| Affinity purified |
| Western Blot 1:100 - 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| DKFZp686C01211, DNA binding factor KBF1, DNA-binding factor KBF1, EBP-1, KBF1, NF-kappaB, NF-kappa-B, NF-kappabeta, NFKB-p105, NFKB-p50, nuclear factor kappa-B DNA binding subunit, nuclear factor NF-kappa-B p105 subunit, nuclear factor NF-kappa-B p50 subunit, nuclear factor of kappa light polypeptide gene enhancer in B-cells 1MGC54151, p105, p50 | |
| A synthetic peptide corresponding to a sequence within amino acids 41-365 of human NFkB p105/p50 (NP_001158884.1).,, Sequence:, LAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFTSD | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title