missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NFIC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-37935-25ul
This item is not returnable.
View return policy
Description
NFIC Polyclonal specifically detects NFIC in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| NFIC | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| P08651 | |
| NFIC | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYYTSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPS | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CCAAT-binding transcription factor, CTF5, CTFCCAAT-box-binding transcription factor, MGC20153, NF1-C, NFI, NF-I, NF-I/C, NFI-C, nuclear factor 1 C-type, Nuclear factor 1/C, Nuclear factor I/C, nuclear factor I/C (CCAAT-binding transcription factor), TGGCA-binding protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 4782 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction