missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Neuropilin-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
386.00€ - 529.00€
Specifications
| Antigen | Neuropilin-1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18403441
|
Novus Biologicals
NBP1-85763-25ul |
25 μL |
386.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18244627
|
Novus Biologicals
NBP1-85763 |
0.1 mL |
529.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Neuropilin-1 Polyclonal specifically detects Neuropilin-1 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Neuropilin-1 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| BDCA4, CD304, CD304 antigen, DKFZp686A03134, DKFZp781F1414, neuropilin 1, neuropilin-1, NP1, NRP, transmembrane receptor, Vascular endothelial cell growth factor 165 receptor, VEGF165R | |
| NRP1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Adaptive Immunity, Angiogenesis, Breast Cancer, Cancer, Cardiovascular Biology, Neuroscience, Virology Bacteria and Parasites | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 8829 | |
| Neuropilin-1 Antibody was developed against a Recombinant Protein corresponding to amino acids: EGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 103 kDa |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title