missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16169583

NEIL2, Mouse anti-Human, Clone: 1B7, Abnova™

Product Code. 16169583
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
16169583 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16169583 Supplier Abnova Supplier No. H00252969M01.100ug
 Restricted Item
Estimated Shipment: 23-10-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Sequence: MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS

Specifications

Antigen NEIL2
Applications ELISA, KnockDown, Western Blot
Classification Monoclonal
Clone 1B7
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene nei like 2 (E. coli)
Gene Accession No. BC013964
Gene Alias FLJ31644/MGC2832/MGC4505/NEH2/NEI2
Gene Symbols NEIL2
Host Species Mouse
Immunogen NEIL2 (AAH13964, 1 a.a. ∼ 332 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 252969
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.