missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NCF4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 593.00€
Specifications
| Antigen | NCF4 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18243994
|
Novus Biologicals
NBP2-58290 |
100 μL |
593.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18629536
|
Novus Biologicals
NBP2-58290-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NCF4 Polyclonal specifically detects NCF4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| NCF4 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| MGC3810, NCF, NCF-4, neutrophil cytosol factor 4, neutrophil cytosolic factor 4 (40kD), neutrophil cytosolic factor 4, 40kDa, Neutrophil NADPH oxidase factor 4, p40phox, p40-phox, SH3 and PX domain-containing protein 4, SH3PXD4P40PHOX | |
| NCF4 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 4689 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title