missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NCF4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37904-20ul
This item is not returnable.
View return policy
Description
NCF4 Polyclonal antibody specifically detects NCF4 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| NCF4 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| MGC3810, NCF, NCF-4, neutrophil cytosol factor 4, neutrophil cytosolic factor 4 (40kD), neutrophil cytosolic factor 4, 40kDa, Neutrophil NADPH oxidase factor 4, p40phox, p40-phox, SH3 and PX domain-containing protein 4, SH3PXD4P40PHOX | |
| A synthetic peptide corresponding to a sequence within amino acids 1-190 of human NCF4 (NP_038202.2).,, Sequence:, EIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLL | |
| 20 μL | |
| Signal Transduction | |
| 4689 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction